DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D3 and eff

DIOPT Version :9

Sequence 1:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens
Sequence 2:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster


Alignment Length:144 Identity:132/144 - (91%)
Similarity:139/144 - (96%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     6 KCLSKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVA 70
            |.::|||.||.|||||||||||||||:||||||||||.|||||||||||||||||||||||||||
  Fly     4 KRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68

Human    71 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDK 135
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|
  Fly    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREK 133

Human   136 YNRISREWTQKYAM 149
            ||.::||||:||||
  Fly   134 YNELAREWTRKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D3NP_871622.1 UBCc 6..148 CDD:412187 129/141 (91%)
effNP_001262578.1 UBCc 1..146 CDD:412187 129/141 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 282 1.000 Domainoid score I1664
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 300 1.000 Inparanoid score I2702
Isobase 1 0.950 - 0 Normalized mean entropy S23
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 1 1.000 - - otm41531
orthoMCL 1 0.900 - - OOG6_100671
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2321
SonicParanoid 1 1.000 - - X311
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.820

Return to query results.
Submit another query.