DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D3 and CG10862

DIOPT Version :9

Sequence 1:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:141 Identity:74/141 - (52%)
Similarity:103/141 - (73%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     8 LSKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 72
            |.:|:|:.:.|....|.|..|||::|||.|||.||:::.|:||.|.:.|.||.:|||.||.:||.
  Fly   213 LRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFL 277

Human    73 TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYN 137
            |:.||.||..:|.||||||.|:|||||::||||:||.|||.||||.||:...:|.::|.:|..::
  Fly   278 TKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALHD 342

Human   138 RISREWTQKYA 148
            :.:||||:|||
  Fly   343 KNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D3NP_871622.1 UBCc 6..148 CDD:412187 72/139 (52%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 74/141 (52%)
UQ_con 212..349 CDD:278603 69/135 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.