DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D3 and Ubc2

DIOPT Version :9

Sequence 1:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:146 Identity:91/146 - (62%)
Similarity:113/146 - (77%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     3 SNRKCLSKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPP 67
            ::.|.:.|||:::..|||..|||||.||:::.|.:||:||..|.|:||||||.|||..:||||||
  Fly    86 TSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPP 150

Human    68 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 132
            ||.|.|||||.||||.|.||||||:..||||||||||||||||||.|.||.||||..||..|..:
  Fly   151 KVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQN 215

Human   133 RDKYNRISREWTQKYA 148
            |::::||:|.||::||
  Fly   216 REEHDRIARLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D3NP_871622.1 UBCc 6..148 CDD:412187 89/141 (63%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 89/144 (62%)
UQ_con 90..227 CDD:278603 86/136 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.