DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D2 and eff

DIOPT Version :10

Sequence 1:XP_047273646.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens
Sequence 2:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster


Alignment Length:139 Identity:132/139 - (94%)
Similarity:135/139 - (97%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    35 ELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 99
            ||.||.|||||||||||||||:||||||||||.||||||||||||||||||||||||||||||||
  Fly     9 ELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 73

Human   100 YHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIA 164
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.:|
  Fly    74 YHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELA 138

Human   165 REWTQKYAM 173
            ||||:||||
  Fly   139 REWTRKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D2XP_047273646.1 UBCc_UBE2D 35..171 CDD:467412 128/135 (95%)
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 128/135 (95%)

Return to query results.
Submit another query.