DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D2 and Ubc6

DIOPT Version :10

Sequence 1:XP_047273646.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens
Sequence 2:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:124 Identity:56/124 - (45%)
Similarity:82/124 - (66%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    39 LARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPN 103
            |..|||...|..|..:::..|.|.|.||:|:|::.|.|.|||.|..:||.|||.|.|.::::|||
  Fly    16 LQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPN 80

Human   104 INSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNR 162
            :.::|.||||||:::|||...:|.:|.||.|||.||||:.|.....|::||.:|.:|.:
  Fly    81 VYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D2XP_047273646.1 UBCc_UBE2D 35..171 CDD:467412 56/124 (45%)
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 56/124 (45%)

Return to query results.
Submit another query.