DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D2 and CG10862

DIOPT Version :9

Sequence 1:XP_016865309.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:138 Identity:73/138 - (52%)
Similarity:101/138 - (73%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    35 ELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 99
            |:::.:.|....|.|..|||::|||.|||.||:::.|:||.|.:.|.||.:|||.||.:||.|:.
  Fly   216 EISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFLTKT 280

Human   100 YHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIA 164
            ||.||..:|.||||||.|:|||||::||||:||.|||.||||.||:...:|.::|.:|..:::.|
  Fly   281 YHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALHDKNA 345

Human   165 REWTQKYA 172
            ||||:|||
  Fly   346 REWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D2XP_016865309.1 COG5078 35..173 CDD:227410 73/138 (53%)
UBCc 35..172 CDD:294101 71/136 (52%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 73/138 (53%)
UQ_con 212..349 CDD:278603 68/132 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.