DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D2 and Ubc2

DIOPT Version :9

Sequence 1:XP_016865309.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:138 Identity:91/138 - (65%)
Similarity:107/138 - (77%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    35 ELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 99
            ||.::..|||..|||||.||:::.|.:||:||..|.|:||||||.|||..:||||||||.|.|||
  Fly    94 ELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRI 158

Human   100 YHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIA 164
            ||.||||.|.||||||:..||||||||||||||||||.|.||.||||..||..|..:||:::|||
  Fly   159 YHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIA 223

Human   165 REWTQKYA 172
            |.||::||
  Fly   224 RLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D2XP_016865309.1 COG5078 35..173 CDD:227410 91/138 (66%)
UBCc 35..172 CDD:294101 89/136 (65%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 89/136 (65%)
UQ_con 90..227 CDD:278603 87/132 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.