DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2D2 and morgue

DIOPT Version :10

Sequence 1:XP_047273646.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:210 Identity:76/210 - (36%)
Similarity:106/210 - (50%) Gaps:49/210 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     6 WPIDFLFPAAIGDWAEWTRLPFGNFL-------CAFELNDLARDPPAQ----------------- 46
            ||   ||. ::.|...|.|| :|..:       |..|:....:|  ||                 
  Fly   282 WP---LFD-SLADNPNWYRL-YGALMSSCFCRTCLIEMGGRGQD--AQEADPQLGDREPGNVMRN 339

Human    47 -----------------CSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVA 94
                             .||.|:.....:|||||:||..|||:||.|||.|:||..||..||.|.
  Fly   340 NFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVR 404

Human    95 FTTRIYHPNINSNGSICLDILRS-QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRE 158
            |.|:|.|||::.:|.:.:||.:. .||.||.::|||||:.|||.||..:..:.||:..||:.:||
  Fly   405 FLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERE 469

Human   159 KYNRIAREWTQKYAM 173
            ::.::.|.||.||||
  Fly   470 RFEQLVRAWTWKYAM 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2D2XP_047273646.1 UBCc_UBE2D 35..171 CDD:467412 62/170 (36%)
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 59/145 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.