DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2B and Ubc87F

DIOPT Version :9

Sequence 1:NP_003328.1 Gene:UBE2B / 7320 HGNCID:12473 Length:152 Species:Homo sapiens
Sequence 2:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster


Alignment Length:154 Identity:57/154 - (37%)
Similarity:89/154 - (57%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     9 LMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRF 72
            |.|....||..|..|.| |..|:::|.:|..||.||..|.:|.|.||..:.|.:|||.:||.::|
  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKF 74

Human    73 LSKMFHPNVYADGSICLDIL-------------QNRWSPTYDVSSILTSIQSLLDEPNPNSPANS 124
            :::::|||:...|.:|:.||             :.||.|.:.|.:||.|:.|:|.:||..|.||.
  Fly    75 ITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANV 139

Human   125 QAAQLYQENKREYEKRVSAIVEQS 148
            .||:.|:||..|::::|:..|.:|
  Fly   140 DAAKEYRENYAEFKRKVTRCVRRS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2BNP_003328.1 UQ_con 8..145 CDD:395127 55/149 (37%)
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 56/152 (37%)
UQ_con 10..160 CDD:278603 55/149 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.