DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2B and CG17030

DIOPT Version :9

Sequence 1:NP_003328.1 Gene:UBE2B / 7320 HGNCID:12473 Length:152 Species:Homo sapiens
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:136 Identity:37/136 - (27%)
Similarity:70/136 - (51%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    13 FKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMF 77
            |:.|..:|          |||.:|..::. |...|::.|.:|:.|:|..:||.|||.:...::|:
  Fly    31 FRNLLVEP----------NNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMY 84

Human    78 HPNVYADGSICLDILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV 141
            |.||...|.:|:.||: ..|.||..:..:|..:.:.:::|.|.:..:.:.|..|:.:...:.|..
  Fly    85 HLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMA 149

Human   142 SAIVEQ 147
            .|.|::
  Fly   150 DAWVQK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2BNP_003328.1 UQ_con 8..145 CDD:395127 36/132 (27%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 37/136 (27%)
UQ_con 14..153 CDD:278603 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.