DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBB and CG7215

DIOPT Version :10

Sequence 1:NP_061828.1 Gene:UBB / 7314 HGNCID:12463 Length:229 Species:Homo sapiens
Sequence 2:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster


Alignment Length:86 Identity:15/86 - (17%)
Similarity:31/86 - (36%) Gaps:24/86 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    91 KEKQPEEPVPDSMGDLENVKRV------------------SGPW-----STVNPVRVLVPEFRHG 132
            |.:.|::...|::|:...||.|                  .|.|     |.:.|..::...|:..
  Fly    50 KTETPKDIHADAVGESSFVKFVDSTAELLLSRKINVILFMGGIWHSASSSAIAPFHLVANHFKES 114

Human   133 WQQ-SFNVLQLQELESIFQCN 152
            ... .|:::.:.|.:..:..|
  Fly   115 KNLIDFSIVDVSETKLPYNLN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBBNP_061828.1 Ubl_ubiquitin 1..76 CDD:340501
Ubl_ubiquitin 77..152 CDD:340501 14/84 (17%)
Ubl_ubiquitin 153..228 CDD:340501 15/86 (17%)
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 6/21 (29%)
Tugs 87..121 CDD:465528 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.