DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a23 and CG33233

DIOPT Version :9

Sequence 1:NP_001028339.1 Gene:Slc22a23 / 73102 MGIID:1920352 Length:689 Species:Mus musculus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:460 Identity:93/460 - (20%)
Similarity:177/460 - (38%) Gaps:104/460 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   230 SLLVGLIFGYLITGCIADWVGRRPVLLFSTIFILIFGLTVALSVNVTMFSTLRFFEGFCLA---- 290
            |||.|::...|..|.:||..||:.|:..:.:..|.|.:..||..::...|.:|...|..|:    
  Fly    64 SLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVAS 128

Mouse   291 ---GIILTLYALR-----IELCPPGKRFIITMVASFVAMAGQFLMPG-----LAAL--CRDWQVL 340
               |.:...:|::     :.:|...:...: :....||||   ::|.     |::.  .|.|:.|
  Fly   129 LQVGFLGEFHAIKWRPITVAICSQSQGLAL-IYCPLVAMA---ILPNNFNVDLSSSYNLRVWRFL 189

Mouse   341 QALIICPFLLMLLYWSIFPESLRWLMATQQFESAKKLILYLTQKN---------CVSPE----SD 392
            ....:.|..|.|:...:.||:..:||:..:.:.|...:.::.:.|         .:|.|    :|
  Fly   190 MMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTND 254

Mouse   393 IKGVMPEL---EKELSRRPKK----VCIVKVVGT------RNLWKNIV---------VLC--VNS 433
            .:|....:   .|.|..:|..    :|:..:.|.      ..:|..::         .||  ||:
  Fly   255 QEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNN 319

Mouse   434 LTGYGIHHCFARSMMGHEVKVP--------LLENFYADYYTMASIALASCLAMCLVVKFLGRRGG 490
            ...:..|.  |....|.:.:.|        |::..|..:..:....|||.|...:..|::     
  Fly   320 NPTFINHE--ADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYV----- 377

Mouse   491 LLLFMILTALASLLQLGL-LNLIGKYSQHPDSELQLKLAVGMSDSVKDKFSIAFSIVGMFASHAV 554
                :.|..|.|:: ||: ||::    :.|...|                  .|.::.|.....:
  Fly   378 ----IALHILISMI-LGISLNIM----KQPTVVL------------------IFFVLMMVLPGVL 415

Mouse   555 GSLSVFFCAEITPTVIRCGGLGLVLASAGF-GMLTAPIIELHNQKGYFLHHIIFACCTLICIICI 618
            ..|:.....:..|..:|...|.:|.:.|.| |:|.:.:|.|..:....:...||..|..||::..
  Fly   416 IPLATSVLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLA 480

Mouse   619 LLLPE 623
            :..|:
  Fly   481 VFQPK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a23NP_001028339.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
2A0119 98..631 CDD:273328 93/460 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..188
MFS 230..>359 CDD:119392 34/147 (23%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 85/424 (20%)
MFS 23..>208 CDD:119392 34/147 (23%)
MFS 354..>482 CDD:304372 32/159 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.