DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and dpr21

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:241 Identity:48/241 - (19%)
Similarity:86/241 - (35%) Gaps:75/241 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    62 LNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIG---------------FLSLKSVERSD 111
            |||.::.:....:.|::      :.|...:.|||..:..               .|.:|..:..|
  Fly    71 LNCRIKNLGNKTVSWIR------HRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRD 129

Human   112 AGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEP-------KDLAVPPNAPFQLSCEAVGPPE-P 168
            :|.|.|||      ..:.||..|   :.|..|||       .::.:...:...|:|.....|: |
  Fly   130 SGIYECQV------STTPPVGYT---MVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPP 185

Human   169 VTIVWWRGTTKIGGPAPSPSVLNVT---------------GVTQSTMFSCEAHNLKGLASSRTAT 218
            :::.|.....:|...:|...|..:|               .:..|..::|...|    |:|::..
  Fly   186 ISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN----ANSKSVN 246

Human   219 VHLQA--LPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQV 262
            ||:..  .|||        :..|:..|:        .||..|.:|:
  Fly   247 VHILKGDHPAA--------VQKSHLLVS--------ELLSLCFLQI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653 18/87 (21%)
IGc2 56..121 CDD:197706 16/73 (22%)
Ig2_Tyro3_like 141..220 CDD:143226 17/101 (17%)
IG_like 145..220 CDD:214653 15/97 (15%)
FN3 225..317 CDD:238020 9/38 (24%)
fn3 324..406 CDD:278470
PTKc_Tyro3 508..791 CDD:270659
Pkinase_Tyr 518..786 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
dpr21NP_001163838.2 Ig 71..149 CDD:299845 19/92 (21%)
IG_like 71..140 CDD:214653 16/80 (20%)
IG_like 162..249 CDD:214653 15/90 (17%)
IGc2 169..242 CDD:197706 13/76 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.