DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and Alk

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster


Alignment Length:493 Identity:145/493 - (29%)
Similarity:226/493 - (45%) Gaps:89/493 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   383 GWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALA 447
            ||..::|        |...|         ...:.||:     |...::..:|.:..|::.....|
  Fly  1080 GWSLKRD--------NHTAC---------EIREEAGK-----SSFQYLVSILMISLAVLFICIAA 1122

Human   448 LILL------RKRRKETRFGQAF--DSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDEL 504
            ||.:      ||::.:.|.....  |..:.|....:......:||           .:.|....|
  Fly  1123 LIFMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFN-----------PNYGCDGIL 1176

Human   505 KEKLEDVLIPE---QQFTLGRMLGKGEFGSVREAQLKQEDGSFVK--VAVKMLKADIIASSDIEE 564
            ...::...:|:   ....|...||||.||.|..|..:..||..|:  ||||.|:.|.....: |:
  Fly  1177 NGHIDVNSLPQVARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKE-ED 1240

Human   565 FLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFNLP 628
            ||:|||.|.:|:||::..|:||..     .|.|. .::|..:..|||..||..:| ..|.|..|.
  Fly  1241 FLKEAAIMAKFNHPNMVHLIGVCF-----DRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLT 1299

Human   629 LQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAE---DMTVCVADFGLSRKIYSGDYYRQGC 690
            ::.|:...:|:|.|..|:.|:.|||||:|||||:|:.   ...|.:||||:||.||..||||:|.
  Fly  1300 MKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGG 1364

Human   691 ASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPP 755
            .:.||:||:..|:..|.::|.::|||:||:.:||:.:.|::||.|..|.::...::.|.||..|.
  Fly  1365 KAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPT 1429

Human   756 ECMEDVYDLMYQCWSADPKQRPSF--------------TCLRMELENILGQLSVLSASQDPLYIN 806
            ||...:|.:|..||:..|:.||:|              :.:...|.||||.   .::.:|...|.
  Fly  1430 ECPVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMNAPLPNILGP---TASERDDTVIR 1491

Human   807 IERAEE----------PTAGGSLELPGRDQPYSGAGDG 834
            ....||          |...|     |.:.|...:|.|
  Fly  1492 PPNGEEFCLAVPDYLVPLPPG-----GSNNPSMASGSG 1524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653
IGc2 56..121 CDD:197706
Ig2_Tyro3_like 141..220 CDD:143226
IG_like 145..220 CDD:214653
FN3 225..317 CDD:238020
fn3 324..406 CDD:278470 5/22 (23%)
PTKc_Tyro3 508..791 CDD:270659 111/305 (36%)
Pkinase_Tyr 518..786 CDD:285015 107/287 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 108/282 (38%)
TyrKc 1193..1460 CDD:197581 107/273 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.