Sequence 1: | NP_006284.2 | Gene: | TYRO3 / 7301 | HGNCID: | 12446 | Length: | 890 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
Alignment Length: | 265 | Identity: | 55/265 - (20%) |
---|---|---|---|
Similarity: | 82/265 - (30%) | Gaps: | 87/265 - (32%) |
- Green bases have known domain annotations that are detailed below.
Human 34 LLPESAAAGLKLMGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWV-------------------KD 79
Human 80 GAVVQN-----------LDQLYIPV--------------------SEQHWIGFLSLKSVERSDAG 113
Human 114 RYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPF-------QLSCEAVGPPE-PVT 170
Human 171 IVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTK 235
Human 236 LSSSN 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TYRO3 | NP_006284.2 | IG_like | 49..135 | CDD:214653 | 28/135 (21%) |
IGc2 | 56..121 | CDD:197706 | 21/114 (18%) | ||
Ig2_Tyro3_like | 141..220 | CDD:143226 | 18/86 (21%) | ||
IG_like | 145..220 | CDD:214653 | 17/82 (21%) | ||
FN3 | 225..317 | CDD:238020 | 5/16 (31%) | ||
fn3 | 324..406 | CDD:278470 | |||
PTKc_Tyro3 | 508..791 | CDD:270659 | |||
Pkinase_Tyr | 518..786 | CDD:285015 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 815..837 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 851..871 | ||||
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 28/142 (20%) |
Ig | <298..338 | CDD:299845 | 16/50 (32%) | ||
IG_like | 352..447 | CDD:214653 | 20/92 (22%) | ||
Ig | 358..439 | CDD:143165 | 20/86 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |