DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and dpr10

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:311 Identity:61/311 - (19%)
Similarity:99/311 - (31%) Gaps:104/311 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    49 PVKLTVSQGQPVKLNCSVEGMEEPDIQWVKD--------GAVVQNLDQLYIPVSEQH-----WIG 100
            |..:|...|:...|.|.|:.:....:.|::.        |......||.:  .:..|     |. 
  Fly    60 PRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRF--QTSYHRDIDEWT- 121

Human   101 FLSLKSVERSDAGRYWCQVE-----------------DGGETEISQPVW---------------- 132
             |.:|..::.|||.|.||:.                 |...::|.|..:                
  Fly   122 -LQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSS 185

Human   133 ----------LTVEGVPFFTV-EPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKI------ 180
                      :....||..|: ...||.|...:...|:|.....|||.|.::|....|:      
  Fly   186 NDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETS 250

Human   181 GG--------PAPSPSVLNV--TGVTQSTMFSC----------EAHNLKGLASSRTATVHLQALP 225
            ||        ...:.|:|.:  ..:..|..:||          ..|.|:|   .|...:...|.|
  Fly   251 GGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQG---ERPEAMQTNAAP 312

Human   226 AA--------PFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGG 268
            ||        .|......:...:..||.:      .||::|:..:.|:.||
  Fly   313 AAVALACWSCHFGQATQAVRVISTMVAAL------VLLEACSSLLLQSGGG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653 23/141 (16%)
IGc2 56..121 CDD:197706 18/94 (19%)
Ig2_Tyro3_like 141..220 CDD:143226 23/105 (22%)
IG_like 145..220 CDD:214653 22/100 (22%)
FN3 225..317 CDD:238020 12/52 (23%)
fn3 324..406 CDD:278470
PTKc_Tyro3 508..791 CDD:270659
Pkinase_Tyr 518..786 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
dpr10NP_729591.1 Ig 63..143 CDD:299845 19/83 (23%)
IG_like 210..297 CDD:214653 18/86 (21%)
IGc2 217..287 CDD:197706 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.