DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and Dscam1

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:442 Identity:100/442 - (22%)
Similarity:180/442 - (40%) Gaps:86/442 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    49 PVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAV---------VQNLDQLYIPVSEQHWIGFLSL 104
            |.....:||...|:.|..:|..:|.:.|.|  ||         ::..|.  |.|.|    |.|.:
  Fly   728 PTDKAFAQGSDAKVECKADGFPKPQVTWKK--AVGDTPGEYKDLKKSDN--IRVEE----GTLHV 784

Human   105 KSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPV 169
            .::::::.|.|.|:..:|..:.:|..:.::|:..|.||.:.::.......|..|.|||.| .:|:
  Fly   785 DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG-EKPI 848

Human   170 TIVWWRGTTKIG----------------GPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTAT 218
            .|:|.....::.                |...|.|:.. |..:.|.:|:|.|.|..|   |..|:
  Fly   849 GILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKR-TERSDSALFTCVATNAFG---SDDAS 909

Human   219 VHL--QALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGW-EVLAVVVPVPP 280
            :::  |.:|..|:.:.|...|..:..::|....||.:.|....::..::...| |:..|:||...
  Fly   910 INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIVPGHT 974

Human   281 FTCLLRDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLI------ 339
            ....::.|.|||.|::|:...||:|.|..::.|...|...||:..|||:.....:...:      
  Fly   975 TEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQTTMRVTWKP 1039

Human   340 ---LEWE-EVIPEAPLEGPLGPYKLS------------WVQDNGTQDELTVEGTRANLTGWDPQK 388
               .||. |::      |....||||            ::.:.|.:..|.::..|..     .|.
  Fly  1040 PPRTEWNGEIL------GYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVY-----TQY 1093

Human   389 DLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHS----------RTSWV 430
            .::::  ..|.:|.||.|:.....:.:....|.|..:          |..||
  Fly  1094 SVVIQ--AFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV 1143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653 22/94 (23%)
IGc2 56..121 CDD:197706 19/73 (26%)
Ig2_Tyro3_like 141..220 CDD:143226 23/94 (24%)
IG_like 145..220 CDD:214653 21/90 (23%)
FN3 225..317 CDD:238020 24/92 (26%)
fn3 324..406 CDD:278470 19/103 (18%)
PTKc_Tyro3 508..791 CDD:270659
Pkinase_Tyr 518..786 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706 20/76 (26%)
I-set 819..914 CDD:254352 24/99 (24%)
Ig 833..921 CDD:299845 23/92 (25%)
FN3 918..1011 CDD:238020 24/92 (26%)
FN3 1018..1116 CDD:238020 20/110 (18%)
FN3 1124..1217 CDD:238020 4/20 (20%)
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.