DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and Lar

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster


Alignment Length:516 Identity:127/516 - (24%)
Similarity:212/516 - (41%) Gaps:91/516 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    23 LGLLLAALASLLLPE--SAAAGLKLM-GAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQ 84
            :|..::|.|:|.:.|  ...||..:: ..|....:..|..|.:.|...|...|:|.|:|      
  Fly   117 VGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIK------ 175

Human    85 NLDQLYIPVSEQHWI---GFLSLKSVERSDAGRYWCQVEDGGETEISQP--VWLTVEGV-PFFTV 143
              :|..:.:|...:.   |||.:::....|.|:|.|..|:...||.|:.  :::.|..| |.|:.
  Fly   176 --NQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSR 238

Human   144 EPKDLA-VPPNAPFQLSCEAVGPPEPVTIVWWRGTTKIGGPAPSP---SVLNVTGVTQSTMFSCE 204
            .|:.:: |...:...|||.|||.|.| .:.|.:|:..:......|   :||.:..:.:|..::|.
  Fly   239 PPETISEVMLGSNLNLSCIAVGSPMP-HVKWMKGSEDLTPENEMPIGRNVLQLINIQESANYTCI 302

Human   205 AHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGW 269
            |.:..|...| .:.|.:|:||.||.::.::::::::..:.|  ...|...||...:|. :.....
  Fly   303 AASTLGQIDS-VSVVKVQSLPTAPTDVQISEVTATSVRLEW--SYKGPEDLQYYVIQY-KPKNAN 363

Human   270 EVLAVVVPVPPFTCLLRDLVPATNYSLRVRCANALGPSPYADWVP-------FQTKGLAPASAPQ 327
            :..:.:..:.....::|.|.|.|.|...|...|.:|..|.:  .|       |...|....|||:
  Fly   364 QAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPS--APATCTTGDFSFGGTKMESAPR 426

Human   328 NLHAIRT--DSGLILEWEEVIPEAPLEGPLGPYKL-----------SWVQDNGTQDELTVEGTRA 379
            |:. :||  .|.:::.||.  ||.| .|.:..||:           ||........|||   |.:
  Fly   427 NVQ-VRTLSSSTMVITWEP--PETP-NGQVTGYKVYYTTNSNQPEASWNSQMVDNSELT---TVS 484

Human   380 NLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAA 444
            .||   |.....|||....::|.||.|.|:.|.:     |||.|...:::....:|         
  Fly   485 ELT---PHAIYTVRVQAYTSMGAGPMSTPVQVKA-----QQGVPSQPSNFRATDIG--------- 532

Human   445 ALALILLRKRRKETRFGQAFDSVMARGEPAVHFRA------ARSFNRERPERIEA-TLDSL 498
                        ||.....:.......|..||:..      |...:.:|....|| |||.|
  Fly   533 ------------ETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHKRISNSEAYTLDGL 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653 22/90 (24%)
IGc2 56..121 CDD:197706 17/67 (25%)
Ig2_Tyro3_like 141..220 CDD:143226 21/82 (26%)
IG_like 145..220 CDD:214653 20/78 (26%)
FN3 225..317 CDD:238020 19/98 (19%)
fn3 324..406 CDD:278470 30/94 (32%)
PTKc_Tyro3 508..791 CDD:270659
Pkinase_Tyr 518..786 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
LarNP_001260594.1 Ig 35..129 CDD:299845 4/11 (36%)
I-set 36..129 CDD:254352 4/11 (36%)
IG_like 146..227 CDD:214653 22/88 (25%)
Ig 159..228 CDD:299845 19/76 (25%)
I-set 234..318 CDD:254352 23/85 (27%)
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216 18/69 (26%)
fn3 324..404 CDD:278470 16/82 (20%)
FN3 423..514 CDD:238020 32/100 (32%)
FN3 520..610 CDD:238020 15/83 (18%)
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470
PTPc 1476..1731 CDD:214550
PTPc 1503..1731 CDD:238006
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.