DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and dnt

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster


Alignment Length:561 Identity:131/561 - (23%)
Similarity:235/561 - (41%) Gaps:114/561 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   293 NYSLRVRCANALGPSP--YADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPL---- 351
            ||:|     |.:.|.|  ..| :.|..:.||....|.:::.:.:|       :||:|...:    
  Fly    76 NYAL-----NFIVPVPANVKD-ISFTWQSLAGRGLPYSINVVSSD-------QEVLPRPAINVSH 127

Human   352 EGPLGPYKLSW---VQDNGTQD---------ELTVEGTRANLTGWDPQKDLIVR---VCVSNAVG 401
            .|.:.....:|   ::.:|.:.         |:.:..:..|:|      .|:.|   :|:.|.  
  Fly   128 SGEIPTTIQTWSIALKCSGLKAAEVDVTVSLEVVLNRSLNNVT------HLVFRRKKICLMND-- 184

Human   402 CGPWSQPLVVSSHDRAGQQGPPH-------SRTSWVPVVLGVLTALVTAAALALI------LLRK 453
                      |:.|.:.....|.       ..|..:.:|:||..|:.:...|.:|      ...|
  Fly   185 ----------SAEDLSEDVDDPQLLETVMLPPTGLITLVVGVSVAMGSVCLLLMIAYCVKGAANK 239

Human   454 RRKETRFGQ-----AFDSV-------MARGEPA---------VHFRAARSFNRERPERIEATLDS 497
            |:.....||     :|..:       .:.|..|         :|   ..|..|:.|..:|..   
  Fly   240 RQHHQHGGQPMRTSSFQRLNTHPPCQSSMGSAAYMTPSIIAPIH---GSSLPRKVPVSVEQQ--- 298

Human   498 LGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 562
              ..:||..::.::.:...:..|..:|.:|.||.|............||..     |...:...:
  Fly   299 --HPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQDVLVKTV-----AQHASQMQV 356

Human   563 EEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH-GDLHAFLLASRIGENPFN 626
            ...|:|...:....||.:..::|||:....     .|.|:.|.:.: .:|..|||      :|..
  Fly   357 LLLLQEGMLLYGASHPGILSVLGVSIEDHT-----TPFVLYPALNNTRNLKQFLL------DPAC 410

Human   627 LPLQTLIRFMV---DIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQ 688
            ....|.|:.::   .::..:::|.|...:|:|:|.|||::.:.:.|.::|..|||.::..||...
  Fly   411 ARTVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCL 475

Human   689 GCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQ 753
            |.:...||||::||:|....::..||.|||||.|||:.|..:.|||.::..|:.:||..|.||.|
  Fly   476 GDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQ 540

Human   754 PPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLS 794
            |..|.::::.:|..||:..|.:||:|..|:..|.....|::
  Fly   541 PFNCPDELFTIMAYCWALLPAERPTFAQLQSCLSEFYSQIT 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653
IGc2 56..121 CDD:197706
Ig2_Tyro3_like 141..220 CDD:143226
IG_like 145..220 CDD:214653
FN3 225..317 CDD:238020 8/25 (32%)
fn3 324..406 CDD:278470 15/100 (15%)
PTKc_Tyro3 508..791 CDD:270659 81/286 (28%)
Pkinase_Tyr 518..786 CDD:285015 80/271 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
dntNP_001260567.1 WIF 46..182 CDD:128745 24/124 (19%)
PKc_like 310..580 CDD:304357 81/285 (28%)
Pkinase_Tyr 317..573 CDD:285015 80/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.