DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and Ror

DIOPT Version :10

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:404 Identity:134/404 - (33%)
Similarity:205/404 - (50%) Gaps:42/404 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   404 PWSQPLVVSSHDRAGQ--QGPPHSRTSWVPVVLGVLTA--LVTAAALALILLRKRRKETRFGQAF 464
            ||.  .|.||.:|..:  ..|..:...|:.:| |...|  |:.....|:||.::|          
  Fly   290 PWC--FVDSSRERIIELCDIPKCADKIWIAIV-GTTAAIILIFIIIFAIILFKRR---------- 341

Human   465 DSVMARGEPAVHFRAARSF------NRERPERIEATLDSLG-ISDE--LKEKL--EDVLIPEQQF 518
             ::|..|...:|.....|.      |.:.....:|...:|| :||.  |..||  .:.|:....|
  Fly   342 -TIMHYGMRNIHNINTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLIERNTLLRINHF 405

Human   519 TLGRM-----LGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 578
            ||..:     ||:|.||.|.:.||.|.:.:.:.||:|.||.:....:. ::|.||...:.:..|.
  Fly   406 TLQDVEFLEELGEGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQ-QDFKREIELISDLKHQ 469

Human   579 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGM 643
            ::..::||.|...     |..| :..:|.:||||.||:::...|.. :|.....::..:.|:.||
  Fly   470 NIVCILGVVLNKE-----PYCM-LFEYMANGDLHEFLISNSPTEGK-SLSQLEFLQIALQISEGM 527

Human   644 EYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNL 708
            :|||:.:::|||||||||::.|.:.|.::||||||.|||.||||....|.|||:|:..||:....
  Fly   528 QYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGK 592

Human   709 YTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADP 773
            :|.:||||:|||.:|||.:.|..||.|..|.|:.|.:.....|..|..|...||.||.:||....
  Fly   593 FTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYSLMIECWHEQS 657

Human   774 KQRPSFTCLRMELE 787
            .:||:||.:...|:
  Fly   658 VKRPTFTDISNRLK 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 Ig1_Tyro3_like 50..136 CDD:409553
Ig strand A 50..55 CDD:409553
Ig strand B 58..67 CDD:409553
Ig strand C 73..78 CDD:409553
Ig strand C' 81..83 CDD:409553
Ig strand D 87..92 CDD:409553
Ig strand E 97..104 CDD:409553
Ig strand F 113..119 CDD:409553
Ig strand G 125..136 CDD:409553
IgI_2_Axl_Tyro3_like 140..220 CDD:409407
Ig strand A 140..143 CDD:409407
Ig strand A' 146..150 CDD:409407
Ig strand B 154..163 CDD:409407
Ig strand C 168..175 CDD:409407
Ig strand C' 177..180 CDD:409407
Ig strand E 184..195 CDD:409407
Ig strand F 198..207 CDD:409407
Ig strand G 211..220 CDD:409407
FN3 225..317 CDD:238020
fn3 324..406 CDD:394996 1/1 (100%)
PTKc_Tyro3 508..791 CDD:270659 106/287 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 7/23 (30%)
PTKc_Ror 404..673 CDD:270642 104/276 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.