DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and Ror

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:404 Identity:134/404 - (33%)
Similarity:205/404 - (50%) Gaps:42/404 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   404 PWSQPLVVSSHDRAGQ--QGPPHSRTSWVPVVLGVLTA--LVTAAALALILLRKRRKETRFGQAF 464
            ||.  .|.||.:|..:  ..|..:...|:.:| |...|  |:.....|:||.::|          
  Fly   290 PWC--FVDSSRERIIELCDIPKCADKIWIAIV-GTTAAIILIFIIIFAIILFKRR---------- 341

Human   465 DSVMARGEPAVHFRAARSF------NRERPERIEATLDSLG-ISDE--LKEKL--EDVLIPEQQF 518
             ::|..|...:|.....|.      |.:.....:|...:|| :||.  |..||  .:.|:....|
  Fly   342 -TIMHYGMRNIHNINTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLIERNTLLRINHF 405

Human   519 TLGRM-----LGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 578
            ||..:     ||:|.||.|.:.||.|.:.:.:.||:|.||.:....:. ::|.||...:.:..|.
  Fly   406 TLQDVEFLEELGEGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQ-QDFKREIELISDLKHQ 469

Human   579 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGM 643
            ::..::||.|...     |..| :..:|.:||||.||:::...|.. :|.....::..:.|:.||
  Fly   470 NIVCILGVVLNKE-----PYCM-LFEYMANGDLHEFLISNSPTEGK-SLSQLEFLQIALQISEGM 527

Human   644 EYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNL 708
            :|||:.:::|||||||||::.|.:.|.::||||||.|||.||||....|.|||:|:..||:....
  Fly   528 QYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGK 592

Human   709 YTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADP 773
            :|.:||||:|||.:|||.:.|..||.|..|.|:.|.:.....|..|..|...||.||.:||....
  Fly   593 FTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYSLMIECWHEQS 657

Human   774 KQRPSFTCLRMELE 787
            .:||:||.:...|:
  Fly   658 VKRPTFTDISNRLK 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653
IGc2 56..121 CDD:197706
Ig2_Tyro3_like 141..220 CDD:143226
IG_like 145..220 CDD:214653
FN3 225..317 CDD:238020
fn3 324..406 CDD:278470 1/1 (100%)
PTKc_Tyro3 508..791 CDD:270659 106/287 (37%)
Pkinase_Tyr 518..786 CDD:285015 103/272 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 7/23 (30%)
PTKc_Ror 404..673 CDD:270642 104/276 (38%)
Pkinase_Tyr 410..670 CDD:285015 100/267 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.