DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:462 Identity:92/462 - (19%)
Similarity:158/462 - (34%) Gaps:130/462 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    52 LTVSQGQPVKLNCSVEGMEEPDIQW----------VKDGAVVQNLDQLYIPVS----EQHWIGFL 102
            :||..|:.|||.|||:.:....:.|          |.:..:.:|   ..|.|:    ::|...:|
  Fly   122 VTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRN---PRISVTHDKHDRHRTWYL 183

Human   103 SLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFF--TVEPKDLAVPPNAPFQLSCEAVGP 165
            .:.:|...|.|||.||:..  .|..:|..:|.|...|..  ::...|:.|...|...|.|.|.|.
  Fly   184 HINNVHEEDRGRYMCQINT--VTAKTQFGYLNVVV
PPNIDDSLSSSDVIVREGANISLRCRASGS 246

Human   166 PEPVTIVW------------------WRGTTKIGGPAPSPSVLNVTGVTQSTM--FSCEAHNLKG 210
            |.|: |.|                  |.|.|           |.:|.:::..|  :.|.|.|...
  Fly   247 PRPI-IKWKRDDNSRIAINKNHIVNEWEGDT-----------LEITRISRLDMGAYLCIASNGVP 299

Human   211 LASSRTATVHLQALP---------AAP--FNITVTKLSSSN-ASVAWMPGADGRALLQSCTVQVT 263
            ...|:...|.:...|         .||  ||:|:...:.:: .|:.:....:|..:..|...:|.
  Fly   300 PTVSKRIKVSV
DFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVE 364

Human   264 QAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRCAN------------ALGPSPYADWVPFQ 316
            ...|                     :||....:::...|            |..|....|.:...
  Fly   365 ATVG---------------------LPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRL 408

Human   317 TKGLAPASAPQNLHAIRTDSGLILEWEE--VIPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRA 379
            .....|.:|...:::  ||:    .|.|  :.......||.....: :.||..|:.:     :..
  Fly   409 YV
SYPPTTASSGIYS--TDT----HWGENGINNNYAYGGPDSTRSI-YAQDKNTRYQ-----SNL 461

Human   380 NLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSH------DRAGQQG-PPHSRTSWVPVVLGVL 437
            |..|...||..:.:.           ..||:.:.:      :..|.:| .|....:|:.||:..|
  Fly   462 NEIGLSEQKSFLDKT-----------QNPLLANGNANEADAESNGARGHNPSMAIAWLFVVIATL 515

Human   438 TALVTAA 444
            ...:.:|
  Fly   516 LLTIRSA 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653 26/96 (27%)
IGc2 56..121 CDD:197706 21/78 (27%)
Ig2_Tyro3_like 141..220 CDD:143226 21/100 (21%)
IG_like 145..220 CDD:214653 21/94 (22%)
FN3 225..317 CDD:238020 17/115 (15%)
fn3 324..406 CDD:278470 14/83 (17%)
PTKc_Tyro3 508..791 CDD:270659
Pkinase_Tyr 518..786 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/98 (28%)
Ig 130..200 CDD:143165 19/72 (26%)
I-set 226..310 CDD:254352 22/95 (23%)
IGc2 233..298 CDD:197706 18/76 (24%)
Ig 313..410 CDD:299845 17/117 (15%)
IG_like 325..410 CDD:214653 16/105 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.