DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and DIP-theta

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:497 Identity:97/497 - (19%)
Similarity:158/497 - (31%) Gaps:171/497 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    52 LTVSQGQPVKLNCSVEGMEEPDIQW----------VKDGAVVQNLDQLYIPVSEQHWIGFLSLKS 106
            :||...:...|.|.|:.::...|.|          :::..:.:|.........::.||  |.::.
  Fly   139 VTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWI--LRIRD 201

Human   107 VERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEP--KDLAVPPNAPFQLSCEAVGPPEPV 169
            |:.||.|.|.||:..  :...||..:|.|...|.....|  .|:.:...:...|.|.|.|.|.| 
  Fly   202 VKESDKGWYMCQINT--DPMKSQVGYLDVVV
PPDILDYPTSTDMVIREGSNVTLKCAATGSPTP- 263

Human   170 TIVWWRGTTKIGG---PAP--------SPSVLNVTGVTQSTM--FSCEAHNLKGLASSRTATVHL 221
            ||.|.|.    ||   |.|        :.|.|.:..|.:..|  :.|.|.|              
  Fly   264 TITWRRE----GGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASN-------------- 310

Human   222 QALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLR 286
             .:|.     ||:|                |.:|                   :|..||...:..
  Fly   311 -GIPP-----TVSK----------------RVML-------------------IVHFPPMIWIQN 334

Human   287 DLV-PATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAP 350
            .|| .|...::.:.|.:...|.....|:...|                    :|:..|..:||..
  Fly   335 QLVGAALTQNITLECQSEAYPKSINYWMKNDT--------------------IIVPGERFVPETF 379

Human   351 LEGPLGPYKLSW--------VQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQ 407
            ..|    ||::.        :||.|.                       .|....|::|      
  Fly   380 ESG----YKITMRLTIYEVDIQDFGA-----------------------YRCVAKNSLG------ 411

Human   408 PLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALAL-ILLRKRRKETRFGQAFDSVMARG 471
                   |..|.....|     :|....:.|...|.:...: ::|.|..||.|:|.:.:|    .
  Fly   412 -------DTDGAIKLYH-----IPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNS----N 460

Human   472 EPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLI 513
            ....:|....|....:.:|.::  :|.| ||:....|.:|.:
  Fly   461 TNPYNFNPGNSQQNTKLQRGKS--NSKG-SDQSPSGLNNVFV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653 21/92 (23%)
IGc2 56..121 CDD:197706 16/74 (22%)
Ig2_Tyro3_like 141..220 CDD:143226 23/93 (25%)
IG_like 145..220 CDD:214653 23/89 (26%)
FN3 225..317 CDD:238020 15/92 (16%)
fn3 324..406 CDD:278470 13/89 (15%)
PTKc_Tyro3 508..791 CDD:270659 2/6 (33%)
Pkinase_Tyr 518..786 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 22/94 (23%)
IG_like 137..230 CDD:214653 22/94 (23%)
IG_like 240..324 CDD:214653 28/143 (20%)
IGc2 247..310 CDD:197706 20/67 (30%)
Ig 327..419 CDD:299845 24/151 (16%)
IG_like 343..420 CDD:214653 19/136 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.