| Sequence 1: | NP_006284.2 | Gene: | TYRO3 / 7301 | HGNCID: | 12446 | Length: | 890 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
| Alignment Length: | 207 | Identity: | 51/207 - (24%) |
|---|---|---|---|
| Similarity: | 79/207 - (38%) | Gaps: | 47/207 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Human 52 LTVSQGQPVKLNCSVEGMEEPDIQWVKDGAV---------VQNLD--QLYIPVSEQHWIGFLSLK 105
Human 106 SVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVT 170
Human 171 IVWW---RG------------TTKIGGPAPSPSVLNVTGVTQSTM--FSCEAHNLKGLASSRTAT 218
Human 219 VHLQALPAAPFN 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TYRO3 | NP_006284.2 | IG_like | 49..135 | CDD:214653 | 23/93 (25%) |
| IGc2 | 56..121 | CDD:197706 | 19/75 (25%) | ||
| Ig2_Tyro3_like | 141..220 | CDD:143226 | 23/95 (24%) | ||
| IG_like | 145..220 | CDD:214653 | 21/91 (23%) | ||
| FN3 | 225..317 | CDD:238020 | 2/6 (33%) | ||
| fn3 | 324..406 | CDD:278470 | |||
| PTKc_Tyro3 | 508..791 | CDD:270659 | |||
| Pkinase_Tyr | 518..786 | CDD:285015 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 815..837 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 851..871 | ||||
| DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | |
| IG_like | 51..137 | CDD:214653 | |||
| IG_like | 153..237 | CDD:214653 | 23/93 (25%) | ||
| Ig | 161..224 | CDD:299845 | 19/75 (25%) | ||
| IG_like | 252..335 | CDD:214653 | 21/88 (24%) | ||
| Ig | 258..333 | CDD:143165 | 21/80 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||