DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and Ddr

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster


Alignment Length:637 Identity:154/637 - (24%)
Similarity:240/637 - (37%) Gaps:177/637 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   186 SPSVLNVTGVTQ--STMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSNASVAWMPG 248
            ||..||..||.:  :||            ....:::...:|...|||   ..:.:|.||...|..
  Fly   545 SPDTLNGNGVLKVVTTM------------DDNESSIDKNSLYHEPFN---ANMYTSAASACPMND 594

Human   249 ADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRCANALGPSPYADWV 313
            ..    .|..:...|..|   :::.....||....||.:..|..:     .|....|..|.....
  Fly   595 LQ----RQHVSPDYTDVP---DIVCQDYAVPHMQQLLPNAPPCGS-----GCGTGTGTGPGRGSS 647

Human   314 P--FQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKLSWVQDNGTQDELTVEG 376
            |  ....|...|||..:|:|....          :|..|:..||..|                  
  Fly   648 PEFVVATGKVTASARNSLNAATLP----------LPSPPVPPPLEKY------------------ 684

Human   377 TRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALV 441
                          .....||        |:|:.|:         ||.|::|      |.|::..
  Fly   685 --------------YAATPVS--------SKPMPVA---------PPGSQSS------GSLSSST 712

Human   442 TAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKE 506
            |||....                ..|:..|:|. |:....|.|       .|.::....:.:::|
  Fly   713 TAATTPT----------------SGVVGVGKPH-HYNLDMSAN-------FADINEERANCQVQE 753

Human   507 KLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI--------- 562
                  .|.|...:...||.|.||.:...:            ..:|.|.::|.:.:         
  Fly   754 ------FPRQSLVIVEKLGSGVFGELHLCE------------TNVLNATLVAVATLRPGANDHLR 800

Human   563 EEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH--GDLHAFLLASRIGEN-- 623
            :||..:|..:.:...|:||:|||..||..       |:.|:....|  |||:.| |...:.|.  
  Fly   801 KEFRSKAKQLAQLSDPNVARLVGACLRDE-------PICIVQDYSHCLGDLNQF-LQEHVAETSG 857

Human   624 ---PFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFG--LSRKIYSG 683
               ..:|....|:.....||.||::|...||:|||||.|:|::..::.|.|...|  ::|..|:.
  Fly   858 LMAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYAS 922

Human   684 DYYR-QGCASK----LPVKWLALESLADNLYTVQSDVWAFGVTMWEIMT-RGQTPY------AGI 736
            ||.: :|...:    :|::|:|.||:....:|.:||||:|.|.:|||:| ..:.||      :.|
  Fly   923 DYCQLEGFTGRQSQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVI 987

Human   737 EN-AEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELE 787
            || ..||........|..||.|..::||||.:||..|...||||..:.:.|:
  Fly   988 ENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQ 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653
IGc2 56..121 CDD:197706
Ig2_Tyro3_like 141..220 CDD:143226 8/35 (23%)
IG_like 145..220 CDD:214653 8/35 (23%)
FN3 225..317 CDD:238020 19/93 (20%)
fn3 324..406 CDD:278470 11/81 (14%)
PTKc_Tyro3 508..791 CDD:270659 93/311 (30%)
Pkinase_Tyr 518..786 CDD:285015 90/298 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 94/313 (30%)
TyrKc 759..1038 CDD:197581 90/298 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.