DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYRO3 and sdk

DIOPT Version :9

Sequence 1:NP_006284.2 Gene:TYRO3 / 7301 HGNCID:12446 Length:890 Species:Homo sapiens
Sequence 2:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster


Alignment Length:496 Identity:108/496 - (21%)
Similarity:184/496 - (37%) Gaps:124/496 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    21 PRLGLLLAALASLLLPESAAAG-------LKLMGAPV------KLTVSQGQPVKLNCSVEGMEEP 72
            ||:..:.|:.|.|...:.:.:|       .:...||:      .:|...|:...::|...|...|
  Fly   465 PRILRVRASHAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQNVTALDGKDATISCRAVGSPNP 529

Human    73 DIQWVKDGAVVQNLDQLYIPVSEQHWI---GFLSLKSVERSDAGRYWC-QVEDGG---------- 123
            :|.|      :.|..|| :.:|.:..|   |.|.:.::...|||.|.| :..:.|          
  Fly   530 NITW------IYNETQL-VDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSV 587

Human   124 --ETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPE-PVTIVWWR---------G 176
              .|:|.||              |.|..|.......|.|:....|. |..|.|:|         .
  Fly   588 LVRTQIIQP--------------PVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISN 638

Human   177 TTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKL---SS 238
            :.:||..|.....:.....:....::|...: .|...:|.|.:.:..||..|.|:.|.:|   ..
  Fly   639 SQRIGVQADGQLEIQAVRASDVGSYACVVTS-PGGNETRAARLSVIELPFPPSNVKVERLPEPQQ 702

Human   239 SNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVP-PFT---------------CLLRD 287
            .:.:|:|.||.||.:.:....:|..:       ::.:.||| |..               .||.:
  Fly   703 RSINVSWTPGFDGNSPISKFIIQRRE-------VSELGPVPDPLLNWITELSNVSADQRWILLEN 760

Human   288 LVPATNYSLRVRCANALG---PSPYADWVPFQTKGLAPASAPQN-LHAIRTDSGLILEWEEVIPE 348
            |..||.|..||...|.:|   ||..::.|....:  ||:..|.. :.:.|:.|.:|.:|:..:.|
  Fly   761 LKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQE--APSGPPVGFVGSARSMSEIITQWQPPLEE 823

Human   349 ---APLEGPLGPYKL------SWVQDNGTQDELTVEGTR----ANLTGWDPQKDLIVRVCVSNAV 400
               ..:.|.:..|:|      .|...|     :|.|..|    ..|..|   ||.||::...|.:
  Fly   824 HRNGQILGYILRYRLFGYNNVPWSYQN-----ITNEAQRNFLIQELITW---KDYIVQIAAYNNM 880

Human   401 GCGPWSQPLVVSSHDRAGQQGPPH----------SRTSWVP 431
            |.|.:::...:.:.:...:..|.:          :|..|.|
  Fly   881 GVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTP 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYRO3NP_006284.2 IG_like 49..135 CDD:214653 25/107 (23%)
IGc2 56..121 CDD:197706 18/68 (26%)
Ig2_Tyro3_like 141..220 CDD:143226 17/88 (19%)
IG_like 145..220 CDD:214653 17/84 (20%)
FN3 225..317 CDD:238020 29/113 (26%)
fn3 324..406 CDD:278470 23/95 (24%)
PTKc_Tyro3 508..791 CDD:270659
Pkinase_Tyr 518..786 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 851..871
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653
Ig 280..343 CDD:299845
IG_like 375..450 CDD:214653
Ig 378..447 CDD:143165
Ig 506..587 CDD:299845 20/87 (23%)
IG_like 506..587 CDD:214653 20/87 (23%)
I-set 592..682 CDD:254352 20/104 (19%)
Ig 595..682 CDD:299845 19/101 (19%)
FN3 686..789 CDD:238020 28/109 (26%)
FN3 798..893 CDD:238020 23/102 (23%)
FN3 901..1005 CDD:238020 4/21 (19%)
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.