DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYK2 and RAD53

DIOPT Version :9

Sequence 1:NP_001372133.1 Gene:TYK2 / 7297 HGNCID:12440 Length:1257 Species:Homo sapiens
Sequence 2:NP_015172.1 Gene:RAD53 / 855950 SGDID:S000006074 Length:821 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:83/306 - (27%)
Similarity:137/306 - (44%) Gaps:47/306 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   917 QCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGKV 981
            |||......|  .|:.|::.:::....|.   :....|..::.|...|.:......:|:|.|..|
Yeast   153 QCLEQNKVDR--IRSNLKNTSKIASPGLT---SSTASSMVANKTGIFKDFSIIDEVVGQGAFATV 212

Human   982 SLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQL 1046
            .    ......||:..|||.:.......:..|..:|:::|:.|.|..|::.||..||  .:|..:
Yeast   213 K----KAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYED--TESYYM 271

Human  1047 VMEYVPLGSLRDYLPRH-SIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDR--LVK 1108
            |||:|..|.|.|::..| ::|.......::||...:.|:|:....||||...|:|::.|.  |||
Yeast   272 VMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVK 336

Human  1109 IGDFGLAKAVPEGHEYYRVREDGD------SPVFWYAPECLK-----------EYKFYYAS--DV 1154
            |.||||||          |:.:|.      ..:.:.|||.::           |.:..|:|  |:
Yeast   337 ITDFGLAK----------VQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDM 391

Human  1155 WSFGVTLYELLT-HCDSSQSPPTKFLELIG---IAQGQMTVLRLTE 1196
            ||.|..:|.:|| |...|.|...:..:.||   ..:|.:...|::|
Yeast   392 WSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYK2NP_001372133.1 FERM_F1 28..125 CDD:408179
FERM_F2 143..266 CDD:408177
Jak1_Phl 285..432 CDD:407742
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..366
SH2 437..534 CDD:417686
PKc_like 589..937 CDD:419665 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..629
PTKc_Tyk2_rpt2 962..1244 CDD:270664 74/261 (28%)
RAD53NP_015172.1 FHA 63..134 CDD:238017
STKc_Rad53_Cds1 196..465 CDD:271000 73/258 (28%)
FHA 578..684 CDD:238017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.