DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TYK2 and SPAP27G11.07c

DIOPT Version :9

Sequence 1:NP_001372133.1 Gene:TYK2 / 7297 HGNCID:12440 Length:1257 Species:Homo sapiens
Sequence 2:NP_593411.1 Gene:SPAP27G11.07c / 2541953 PomBaseID:SPAP27G11.07c Length:238 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:55/247 - (22%)
Similarity:86/247 - (34%) Gaps:92/247 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   994 GEMVAVKALKADCGPQHRSGWK-----QEIDILRTLYHEHII---KYKGC-C-------EDQGEK 1042
            ||:..:|     |.|..|  |:     |::...|.|....::   .|.|. |       .::|  
pombe    42 GEVCLLK-----CRPAKR--WRHPILDQKLSRKRCLVEARLLAKCHYVGIKCPMLYFIDANRG-- 97

Human  1043 SLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICE----------------GMAYLHAQHYIH 1091
              |:.||::....:|||:              ::|||                .:|.:|....:|
pombe    98 --QIYMEWIDGPCVRDYI--------------REICECEIEKKLIPLMKRIGSEVAKMHKNDIVH 146

Human  1092 RDLAARNVLLD--NDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDV 1154
            .||...|::|:  |:.:....||||. :|.|..|        |..|..|..|             
pombe   147 GDLTTSNMMLESHNNPVPIFIDFGLG-SVSESEE--------DKAVDIYVLE------------- 189

Human  1155 WSFGVTLYE---LLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGER 1203
            .:...||.|   |..|...|.:...|        |.:.|:.|..|:..||.:
pombe   190 RALSSTLPESESLFHHVLDSYAQSWK--------QSKATLRRFEEVRMRGRK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TYK2NP_001372133.1 FERM_F1 28..125 CDD:408179
FERM_F2 143..266 CDD:408177
Jak1_Phl 285..432 CDD:407742
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..366
SH2 437..534 CDD:417686
PKc_like 589..937 CDD:419665
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..629
PTKc_Tyk2_rpt2 962..1244 CDD:270664 55/247 (22%)
SPAP27G11.07cNP_593411.1 Bud32 23..238 CDD:226168 55/247 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.