DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TXNRD1 and Grx1

DIOPT Version :9

Sequence 1:NP_001087240.1 Gene:TXNRD1 / 7296 HGNCID:12437 Length:649 Species:Homo sapiens
Sequence 2:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster


Alignment Length:85 Identity:31/85 - (36%)
Similarity:46/85 - (54%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    63 IDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDLPVVFVKQ 127
            |..:.|||||::.|..||..|:.||.|.|...::|||...||..::..|.|:.....:|.||:..
  Fly    27 IASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELDGNPDGNEIQAVLGEITGARTVPRVFIDG 91

Human   128 RKIGGHGPTLKAYQEGRLQK 147
            :.|||.....:.::.|.|||
  Fly    92 KFIGGGTDIKRMFETGALQK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TXNRD1NP_001087240.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
GRX_GRXh_1_2_like 68..148 CDD:239511 30/80 (38%)
TGR 161..649 CDD:273624
Pyr_redox 342..418 CDD:278498
Pyr_redox_dim 521..631 CDD:280934
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 28/79 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.