DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TXN and Trx-2

DIOPT Version :9

Sequence 1:NP_003320.2 Gene:TXN / 7295 HGNCID:12435 Length:105 Species:Homo sapiens
Sequence 2:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster


Alignment Length:102 Identity:53/102 - (51%)
Similarity:68/102 - (66%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDDCQD 64
            ||.|::.|......|..|..||||:||.||||||||||.|....||.::: ||:.|:||||:|:|
  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 65

Human    65 VASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
            :|.|..:..||||.|.|.|.||.||:|||.::||..|
  Fly    66 IAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TXNNP_003320.2 TRX_family 11..102 CDD:239245 49/92 (53%)
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 48/85 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6921
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128202
Inparanoid 1 1.050 107 1.000 Inparanoid score I4932
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm8571
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - LDO PTHR10438
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.