DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TXK and LSB1

DIOPT Version :9

Sequence 1:XP_024309968.1 Gene:TXK / 7294 HGNCID:12434 Length:530 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:103 Identity:26/103 - (25%)
Similarity:46/103 - (44%) Gaps:30/103 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    38 DEELPEKYTQRRRPWLSQLSNKKQSNTGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPC 102
            :.:||||:...:|.                           |.:...||  .|:|||||..::..
Yeast    35 NSKLPEKWDGNQRS---------------------------PQNADTEE--YVEALYDFEAQQDG 70

Human   103 NLALRRAEEYLILEKYNPHWWKARDRLGNEGLIPSNYV 140
            :|:|:..::..:|||.:|.|::.:.. ...|:.|:|||
Yeast    71 DLSLKTGDKIQVLEKISPDWYRGKSN-NKIGIFPANYV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TXKXP_024309968.1 SH3_TXK 88..142 CDD:212840 18/53 (34%)
SH2_Tec_Txk 146..251 CDD:198261
PTKc_Tec_like 269..524 CDD:173637
LSB1NP_011652.1 SH3 55..108 CDD:214620 20/56 (36%)
PRK14971 <100..>156 CDD:237874 5/8 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.