DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWIST1 and Fer2

DIOPT Version :9

Sequence 1:NP_000465.1 Gene:TWIST1 / 7291 HGNCID:12428 Length:202 Species:Homo sapiens
Sequence 2:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster


Alignment Length:220 Identity:75/220 - (34%)
Similarity:90/220 - (40%) Gaps:73/220 - (33%)


- Green bases have known domain annotations that are detailed below.


Human     6 SSSPVSPA-----DDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGG------- 58
            ||.|:|..     ||.|.|        ..||....|:.:.......|||:|.||.:.|       
  Fly    11 SSPPISHLPFHNFDDDLIN--------DLPSCIYAGQHQGGGATGGGGGSGGGGGSSGLRLSSNN 67

Human    59 ------------------------GV--GGGDEP---GSPAQGKRGKKSAGCGGGGGA--GGGGG 92
                                    ||  .||..|   .||:....|   .|||..|.|  ||.||
  Fly    68 LRHIQQHYMQHSGENLLDSSTNPMGVHNSGGGAPLMCNSPSASSSG---GGCGNAGSATPGGAGG 129

Human    93 SSSGGGS-----PQSYEELQTQRVMANVRERQRTQ----------SLNEAFAALRKIIPTLPSDK 142
            .:.|.||     ..||   :.||..||||||:|.|          |:|.||..||..:||.|.:|
  Fly   130 PNPGYGSVGAATASSY---KMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEK 191

Human   143 -LSKIQTLKLAARYIDFLYQVLQSD 166
             ||||.||:||..||..|.:|||:|
  Fly   192 RLSKIDTLRLAIAYISLLREVLQTD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWIST1NP_000465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 40/146 (27%)
HLH 109..159 CDD:278439 30/60 (50%)
Sufficient for transactivation activity. /evidence=ECO:0000250 161..191 4/6 (67%)
Fer2NP_001287359.1 HLH 148..210 CDD:278439 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5283
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.