DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWIST1 and HLH54F

DIOPT Version :9

Sequence 1:NP_000465.1 Gene:TWIST1 / 7291 HGNCID:12428 Length:202 Species:Homo sapiens
Sequence 2:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster


Alignment Length:97 Identity:32/97 - (32%)
Similarity:50/97 - (51%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    93 SSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYI 156
            :||....|      ..||..||.|||.|.:.|:.|:..|:..:|.:|.| ||||:.||:||..||
  Fly    22 ASSQSSQP------PVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYI 80

Human   157 DFLYQVLQSDELDSKMASCSYVAHERLSYAFS 188
            ..|...:::.. .|:....::..|..|:::.|
  Fly    81 KQLITAVETGS-HSQNHPHNHNQHHSLNHSHS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWIST1NP_000465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 3/11 (27%)
HLH 109..159 CDD:278439 24/50 (48%)
Sufficient for transactivation activity. /evidence=ECO:0000250 161..191 4/28 (14%)
HLH54FNP_477302.1 HLH 32..83 CDD:278439 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.