DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWIST1 and CG33557

DIOPT Version :9

Sequence 1:NP_000465.1 Gene:TWIST1 / 7291 HGNCID:12428 Length:202 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:122 Identity:38/122 - (31%)
Similarity:59/122 - (48%) Gaps:22/122 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    78 SAGCGGGGGAGG-------GGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKII 135
            |:|...|.||..       |..::.||...|.....:..|...|.|||.||.::|.|:.|||.:|
  Fly    24 SSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLI 88

Human   136 PTLPSD-KLSKIQTLKLAARYIDFLYQVL--------------QSDELDSKMASCSY 177
            ||.|.: |||||:.::||:.||..|...|              :|:.:..:::.|::
  Fly    89 PTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICTF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWIST1NP_000465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 9/33 (27%)
HLH 109..159 CDD:278439 25/50 (50%)
Sufficient for transactivation activity. /evidence=ECO:0000250 161..191 3/31 (10%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.