DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZNF736 and syd-9

DIOPT Version :9

Sequence 1:	NP_001164376.1	Gene:	ZNF736 / 728927	HGNCID:	32467	Length:	427	Species:	Homo sapiens
Sequence 2:	NP_001362162.1	Gene:	syd-9 / 180985	WormBaseID:	WBGene00044068	Length:	554	Species:	Caenorhabditis elegans

Alignment Length:	105	Identity:	35/105 - (33%)
Similarity:	48/105 - (45%)	Gaps:	11/105 - (10%)

- Green bases have known domain annotations that are detailed below.

Human   147 CNKCGRGFQLCSIFTEHKDIFSREKCHKCEECGKDCRLFSDFTRHKKIHTVERCYKCEECGKAFK 211
            |.:|.:.|....:..:|:.:|..:|.........|..:..|           |.:.||.|||||:
Worm    22 CPQCPKSFSSTKLLQQHQQMFHTDKSVLLSLKSTDAPVGMD-----------RAFICETCGKAFR 75

Human   212 KFSNLTEHKRVHTGEKPYKCEGCGKTFTCSSTLVKHKRNH 251
            ..|||.||:.|||..|||.|:.|||:......|.||...|
Worm    76 FRSNLAEHRSVHTALKPYVCKFCGKSSRLKGNLTKHILKH 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZNF736	NP_001164376.1	KRAB	4..63	CDD:214630
		KRAB	4..43	CDD:279668
		C2H2 Zn finger	147..167	CDD:275368	4/19 (21%)
		C2H2 Zn finger	175..195	CDD:275368	2/19 (11%)
		C2H2 Zn finger	203..223	CDD:275368	12/19 (63%)
		zf-H2C2_2	215..240	CDD:290200	14/24 (58%)
		COG5048	<227..383	CDD:227381	11/25 (44%)
		C2H2 Zn finger	231..251	CDD:275368	7/19 (37%)
		zf-H2C2_2	244..268	CDD:290200	4/8 (50%)
		C2H2 Zn finger	259..279	CDD:275368
		zf-H2C2_2	271..294	CDD:290200
		C2H2 Zn finger	287..307	CDD:275368
		C2H2 Zn finger	315..335	CDD:275368
		zf-H2C2_2	327..352	CDD:290200
		C2H2 Zn finger	343..363	CDD:275368
		C2H2 Zn finger	371..391	CDD:275368
		zf-H2C2_2	383..407	CDD:290200
		C2H2 Zn finger	399..419	CDD:275368
syd-9	NP_001362162.1	C2H2 Zn finger	22..43	CDD:275368	4/20 (20%)
		zf-C2H2	65..87	CDD:333835	12/21 (57%)
		C2H2 Zn finger	67..87	CDD:275368	12/19 (63%)
		zf-C2H2	93..115	CDD:333835	8/21 (38%)
		C2H2 Zn finger	95..115	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000