DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TULP2 and ktub

DIOPT Version :9

Sequence 1:NP_003314.2 Gene:TULP2 / 7288 HGNCID:12424 Length:520 Species:Homo sapiens
Sequence 2:NP_611549.2 Gene:ktub / 37400 FlyBaseID:FBgn0015721 Length:469 Species:Drosophila melanogaster


Alignment Length:541 Identity:183/541 - (33%)
Similarity:258/541 - (47%) Gaps:125/541 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    21 RLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSCLREERLLGDRGLGNPF--LRKKVSE 83
            |.||:||||:|.|...||||....||||:                   |..:..|.  :|....|
  Fly     7 RNQKMEQQRQLMEAYIRQKRASPGMVQAS-------------------DLQINRPMSGMRSNSRE 52

Human    84 AHL----------------------PSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLGLQSP 126
            .|.                      |.||:......| .......|.|.|...|..:        
  Fly    53 LHAYDGPMQFISSPQNPDQILTNGSPGGINPVAMNTS-RNHSNNMRSLSTINQEGKW-------- 108

Human   127 FLSWLPDNSDAELEEVS---VENGSVSP----PPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDM 184
              |:.|..:|. :||:|   :|:...||    ...:||........|: |:|..|....||:.| 
  Fly   109 --SYTPRKADL-IEEISSHELEDEESSPVTVIEQHQQSASHSANSTQS-QKPRARQHSFSDNLD- 168

Human   185 GDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASES----TGTNSSAAHNEELSKALKGE 245
                                        |:|...:..|..:    .|..||...:..|..:..|.
  Fly   169 ----------------------------EDDYTNRNVAGAAPVRPAGMASSPYKDATLDGSSNGT 205

Human   246 G-GTDSDHMRHEASLAIRSPCPGLEED----MEAYVLRPALPGTMMQCYLTRDKHGVDKGLFPLY 305
            | ||..:.                |.|    ::.:|::||..|.:.:|.:|||:.|:|:||||:|
  Fly   206 GNGTGGES----------------EGDVIGNIDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIY 254

Human   306 YLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGDNFVGKVRSNVFSTKFTIFDNGVN 370
            ||:||.....:.|||.||||::||||||::|.|||.|||:.|.|.||:|||||.|.||:||||  
  Fly   255 YLHLERDYGKKIFLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVFDNG-- 317

Human   371 PDREHLTRNTARIRQELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRINVQPLN-EQESLLSRY 434
             ::|    :|...|.:|..:.|:.|:||:.|||.|||||||....:||:.:...: :|:.:|..:
  Fly   318 -NKE----STESPRLDLAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPKQQGILDLW 377

Human   435 QRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASVKNFQIVDPKHQEHLVLQFGRVGPDTFT 499
            :..:...::.||||||.|:.|...|.||||||||:|||||||:|.....|::|:||||...|.||
  Fly   378 KMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLVHDSDPEYIVMQFGRTSEDVFT 442

Human   500 MDFCFPFSPLQAFSICLSSFN 520
            ||:.:|...:|||:|.||||:
  Fly   443 MDYRYPLCAMQAFAIALSSFD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TULP2NP_003314.2 Tub_N 27..241 CDD:318529 51/248 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..236 20/105 (19%)
Tub 279..519 CDD:307359 119/240 (50%)
ktubNP_611549.2 Tub 228..462 CDD:279506 119/240 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143586
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 1 1.000 - - FOG0000431
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16517
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.