DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB8B and C27A2.7

DIOPT Version :10

Sequence 1:NP_001139192.1 Gene:ZBTB8B / 728116 HGNCID:37057 Length:495 Species:Homo sapiens
Sequence 2:NP_001021993.3 Gene:C27A2.7 / 3565834 WormBaseID:WBGene00044386 Length:202 Species:Caenorhabditis elegans


Alignment Length:63 Identity:26/63 - (41%)
Similarity:35/63 - (55%) Gaps:7/63 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   340 LHKCPF--CPYTA-KQKGILKRHIRSHTGERPYPCETCGKRFTRQEHLRSHALSVHRSNRPII 399
            :||||.  |.:.. |....|..|:|:||  |||.|..|...|.|:..|:|| ||.|::. |:|
 Worm   143 MHKCPVENCTHPGYKCTKALNAHVRTHT--RPYACHRCDASFARKNDLQSH-LSTHQAT-PVI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB8BNP_001139192.1 BTB_POZ_ZBTB8B 6..118 CDD:349639
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..178
zf-H2C2_5 341..365 CDD:404746 10/26 (38%)
C2H2 Zn finger 343..363 CDD:275368 7/22 (32%)
zf-H2C2_2 356..380 CDD:463886 11/23 (48%)
C2H2 Zn finger 371..392 CDD:275368 9/20 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..495
C27A2.7NP_001021993.3 C2H2 Zn finger 118..139 CDD:275368
C2H2 Zn finger 175..195 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.