DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSG101 and TSG101

DIOPT Version :9

Sequence 1:NP_006283.1 Gene:TSG101 / 7251 HGNCID:15971 Length:390 Species:Homo sapiens
Sequence 2:NP_524120.1 Gene:TSG101 / 39881 FlyBaseID:FBgn0036666 Length:408 Species:Drosophila melanogaster


Alignment Length:411 Identity:208/411 - (50%)
Similarity:273/411 - (66%) Gaps:31/411 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     2 AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGN 66
            ||.|:|:.|.:|||||...|.::.|:|:|.::.|...|..:|||||||:||..:.|||||.|:.|
  Fly     3 AVEETQITKYLSKYKYVAATKKDVVDVVTSFRSLTYDLQRFVFNDGSSKELFTIQGTIPVVYKNN 67

Human    67 TYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVM 131
            ||.||||:||:||:|.|.|:||||||.:|.||...:||.|||:||||||:|:...||||.|||||
  Fly    68 TYYIPICIWLMDTHPQNAPMCFVKPTPTMQIKVSMYVDHNGKVYLPYLHDWQPHSSDLLSLIQVM 132

Human   132 IVVFGDEPPVFSRPISASYPPYQATGPPNTSYM--PGMPGGIS---PYP-------SGYPPNPSG 184
            ||.|||.|||:|:|......||     |..|||  ||.|||.:   |||       |.:||.|:|
  Fly   133 IVTFGDHPPVYSKPKEQIAAPY-----PTNSYMPQPGAPGGSNSFLPYPTAGGAGGSNFPPYPTG 192

Human   185 YPGCPYPP-------GGPYPA------TTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSD 236
            ....||||       |..|||      .|:..||.........||..|||:|:.|:||:|||:.|
  Fly   193 SNVGPYPPTPAGPAGGSGYPAYPNFIQPTAGGYPPAAGYNPSNPSSTGTITEEHIKASIISAIDD 257

Human   237 KLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSA 301
            |||.|::|::::.|||:..|.||:::|.:|..|::.::.||::|..::.|||.:||.|::||..|
  Fly   258 KLRRRVQEKVNQYQAEIETLNRTKQELLEGSAKIDAIIERLEREHIDMQKNISILKDKEQELEKA 322

Human   302 LEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLL 366
            ||.:|:....|. ||.:..|||||:|:||.||:|.|.||.|:||||.||.|||||:.||||||.|
  Fly   323 LEDLESAEAINP-DEAVTTTAPLYRQLLNAYADEAATEDAIYYLGEGLRGGVIDLETFLKHVRQL 386

Human   367 SRKQFQLRALMQKARKTAGLS 387
            |||||.|||.|||.|:.|||:
  Fly   387 SRKQFILRATMQKCRQKAGLA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSG101NP_006283.1 UEV 21..139 CDD:399041 70/117 (60%)
Interaction with CEP55 158..162 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..220 6/27 (22%)
DUF1640 <236..292 CDD:400241 21/55 (38%)
Vps23_core 316..375 CDD:401418 40/58 (69%)
PTAP motif 320..323 1/2 (50%)
TSG101NP_524120.1 UEV 22..140 CDD:283415 70/117 (60%)
ARS2 <149..227 CDD:282772 36/102 (35%)
TBPIP <242..353 CDD:284512 50/110 (45%)
Vps23_core 336..393 CDD:286532 38/53 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148018
Domainoid 1 1.000 162 1.000 Domainoid score I3992
eggNOG 1 0.900 - - E1_KOG2391
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4584
Inparanoid 1 1.050 391 1.000 Inparanoid score I2003
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54978
OrthoDB 1 1.010 - - D1435538at2759
OrthoFinder 1 1.000 - - FOG0001267
OrthoInspector 1 1.000 - - oto90988
orthoMCL 1 0.900 - - OOG6_102944
Panther 1 1.100 - - LDO PTHR23306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5678
SonicParanoid 1 1.000 - - X3220
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.