DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbd6 and anox

DIOPT Version :9

Sequence 1:NP_082526.2 Gene:Acbd6 / 72482 MGIID:1919732 Length:282 Species:Mus musculus
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:250 Identity:84/250 - (33%)
Similarity:124/250 - (49%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    39 TRSLAELFEKAAAHVQGLVQVASREQLLYLYARFKQVKVGNCNTPKPNFFDFEGKQKWEAWKALG 103
            |.::.|||..|..||...........||..|..:||...|.|....|.....:.|.||:||:.||
  Fly     6 TDTVDELFHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLG 70

Mouse   104 DSSPSQAMQEYIAAVKKLDPGW----NPQVSEKKGKEGSSGFGGPVVSSLYHEETIREED----- 159
            ..|.|.|.|.|:..:::|.|.|    ||               |.||.|:   |::..||     
  Fly    71 TMSQSAARQAYVQKLQELQPNWRSRRNP---------------GWVVHSI---ESVPLEDQRLDS 117

Mouse   160 -KNIFDYCRENNIDHIAKAIKSKAADVNMTDEEGRALLHWACDRGHKELVKVLLQYEAGINCQDN 223
             |.:||:.:|||:|.:.:.:  :.:|:...||.|.||:|||.||...|:::.|::..|.:|.:|.
  Fly   118 EKTLFDHVKENNLDRLRELL--QPSDLVKLDEHGMALIHWATDRNAVEIIQFLVRSGASVNQRDA 180

Mouse   224 EGQTALHYAAACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKAVSLLLQRHR 278
            |.||.|||||:|..|:.::.||:..|...|||.||....:|...:.:..:||..|
  Fly   181 EQQTPLHYAASCGHLEALQCLLELHASLELRDSDGQTCYDVADDEQICQVLQTER 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbd6NP_082526.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 83/249 (33%)
ACBP 44..123 CDD:279259 27/78 (35%)
Acyl-CoA binding. /evidence=ECO:0000250 69..73 1/3 (33%)
ANK 165..261 CDD:238125 38/95 (40%)
Ank_2 166..255 CDD:289560 34/88 (39%)
ANK repeat 191..222 CDD:293786 12/30 (40%)
ANK 1 191..220 11/28 (39%)
ANK repeat 224..255 CDD:293786 14/30 (47%)
ANK 2 224..253 13/28 (46%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 27/79 (34%)
ANK 125..231 CDD:238125 39/107 (36%)
Ank_2 125..212 CDD:289560 34/88 (39%)
ANK repeat 148..179 CDD:293786 12/30 (40%)
ANK repeat 181..212 CDD:293786 14/30 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848694
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12465
Inparanoid 1 1.050 139 1.000 Inparanoid score I4512
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54934
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005754
OrthoInspector 1 1.000 - - oto92444
orthoMCL 1 0.900 - - OOG6_104190
Panther 1 1.100 - - LDO PTHR24119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5885
SonicParanoid 1 1.000 - - X1917
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.