DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRPC6 and BSC1

DIOPT Version :10

Sequence 1:NP_004612.2 Gene:TRPC6 / 7225 HGNCID:12338 Length:931 Species:Homo sapiens
Sequence 2:NP_010247.1 Gene:BSC1 / 851524 SGDID:S000002195 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:63 Identity:13/63 - (20%)
Similarity:23/63 - (36%) Gaps:13/63 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   466 EGTKLLPNETSTDNAKQLFRMKTS--CFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELW 526
            |.|.|:.:.|...:..|::...:|  |..||....|.:.           :.||.....::.|
Yeast    63 EKTYLISDPTDFTSTFQVYAYPSSDGCTVWMPNFQIQFE-----------YLQGDAAQYWQTW 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRPC6NP_004612.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
trp 82..897 CDD:273311 13/63 (21%)
ANK 1 97..126
ANK 2 132..161
ANK repeat 132..159 CDD:293786
ANK repeat 161..185 CDD:293786
ANK 3 163..189
ANK repeat 212..247 CDD:293786
ANK 4 218..247
BSC1NP_010247.1 Flo11 4..141 CDD:401990 13/63 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.