DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRO and MAGE

DIOPT Version :9

Sequence 1:NP_001034794.1 Gene:TRO / 7216 HGNCID:12326 Length:1431 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:220 Identity:63/220 - (28%)
Similarity:109/220 - (49%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   421 RSGSNYRRIPWGRRPAPPRDVAILQERANKLVKYLLVKDQTKIPIKRSDMLRDVIQEYDEYFPEI 485
            |:..:...|| .:....|.||...:.||  ::.|:|.....|||||..|::. |..:..| ..:.
  Fly     6 RAARSQNAIP-SQEAQQPVDVVDAKVRA--ILNYILDHTAQKIPIKDKDLIA-VAGDKSE-LKKR 65

Human   486 IERASYTLEKMFRVNLKEIDKQSSLYILISTQESSAGILG-TTKDTPKLGLLMVILSVIFMNGNK 549
            :...:..|.:.|.:.|..:|..:..:| .:.:|..|.|.. |....|:..||.:||..||:.||:
  Fly    66 LPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQRPQFTLLYIILMYIFLRGNR 129

Human   550 ASEAVIWEVLRKLGLRPGVRHSLFG-EVRKLITDEFVKQKYLEYKRVPNSRPPEYE-----FFWG 608
            ..::.::.:|..|.:.|...|..|| .:||.|.:.||||:||:.:|   |:...|:     |.||
  Fly   130 IEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYDDSKTFFLWG 191

Human   609 LRSYHETSKMKVLKFACRVQKKDPK 633
            .|:..|.:..::::||.::..:.||
  Fly   192 PRAKAEFTFEQMVQFASKLLNQHPK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRONP_001034794.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..365
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433 3/11 (27%)
MAGE 451..611 CDD:279759 49/166 (30%)
62 X 10 AA approximate tandem repeats 751..1430
YjbI 974..1183 CDD:224276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1342..1365
MAGENP_649702.2 MAGE 36..201 CDD:279759 51/170 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151952
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11736
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.