DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTG2 and Act88F

DIOPT Version :9

Sequence 1:NP_001606.1 Gene:ACTG2 / 72 HGNCID:145 Length:376 Species:Homo sapiens
Sequence 2:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster


Alignment Length:376 Identity:348/376 - (92%)
Similarity:363/376 - (96%) Gaps:0/376 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 65
            ||:::..|||.|||||:||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 65

Human    66 LTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNV 130
            ||||||||||||||||||||||||:|||||||||||||.|||||||||||||||||||||||||.
  Fly    66 LTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNS 130

Human   131 PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILT 195
            ||||||||||||||||||||||||||||||:|.||||||:||||||:||||||||||||||||||
  Fly   131 PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILT 195

Human   196 ERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPE 260
            ||||||.|||||||||||||||||||||||.||||||:|:|||||||||||||||||||||||||
  Fly   196 ERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPE 260

Human   261 TLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPST 325
            .||||||:||||.|||||.||||||||:|||||||||:|||||||||||||||||||||||||||
  Fly   261 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEITALAPST 325

Human   326 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
            :||||||||||||||||||||||||||||||||||.||||:||.|||||||
  Fly   326 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTG2NP_001606.1 PTZ00281 1..376 CDD:173506 346/374 (93%)
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 346/374 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D283838at33208
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X104
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.