DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRAF6 and Traf4

DIOPT Version :9

Sequence 1:NP_004611.1 Gene:TRAF6 / 7189 HGNCID:12036 Length:522 Species:Homo sapiens
Sequence 2:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster


Alignment Length:483 Identity:111/483 - (22%)
Similarity:174/483 - (36%) Gaps:123/483 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    85 CGHRFCKACIIKSIRDAGHKCPV---DNEIL----LENQLFPDNFAKREILSLMVKC--PNEGCL 140
            |......:..:.|...:.|..|.   :|..:    ||..::|....| .|:..:|.|  ..:||.
  Fly    51 CATSRSSSSTVSSSHSSSHSSPTPGNNNNNMPITELEQIIYPGPDPK-HIMGSLVFCIHHKQGCK 114

Human   141 HKMELRHLEDHQAHCEFALMDCPQ----------------------------CQRPFQ------- 170
            ...|||.|:.|...|:.....||.                            ||..|.       
  Fly   115 WSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEH 179

Human   171 --------------------KFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVIC 215
                                :..:.:|..|||.:|...|.:|....:.:...:|...||.|.:.|
  Fly   180 NGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLAC 244

Human   216 -EYCNTILI-REQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVH 278
             :.|:...| |.::..|...:|.:..:.|:|...||..|..|..|..||:.|..:|:        
  Fly   245 PQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHL-------- 301

Human   279 SLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAE 343
            ||.|...|                     ||..||:.|.:.:...|:                  
  Fly   302 SLMVALSS---------------------RQGQQIQMLKSAVSKLSI------------------ 327

Human   344 IEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKL--CMRLHLQLPTAQRCANY 406
                ...|..:|||.::...:.....:..:.:.||.|||.:.||||  .|.|:...|...   .:
  Fly   328 ----NYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGEN---TH 385

Human   407 ISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGF 471
            :|:::..:.||||:.|.|||..:|..|:.:|.....:....|.....|....||||:...:..||
  Fly   386 VSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGF 450

Human   472 GYVTFMHLEALRQRTFIKDDTLLVRCEV 499
            |:..|:..|.|..|.|||.||:.:|.:|
  Fly   451 GFPRFISHELLHSRPFIKGDTVFLRVKV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRAF6NP_004611.1 Interaction with TAX1BP1. /evidence=ECO:0000269|PubMed:10920205 1..354 64/334 (19%)
RING 69..107 CDD:238093 3/21 (14%)
zf-TRAF 204..261 CDD:280357 17/58 (29%)
MATH_TRAF6 351..500 CDD:239745 48/151 (32%)
Interaction with TANK. /evidence=ECO:0000269|PubMed:25861989 355..522 47/147 (32%)
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 13/96 (14%)
zf-TRAF 233..292 CDD:424248 17/58 (29%)
MATH_TRAF4 331..479 CDD:239750 48/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.