DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRAF1 and Traf4

DIOPT Version :9

Sequence 1:NP_001177874.1 Gene:TRAF1 / 7185 HGNCID:12031 Length:416 Species:Homo sapiens
Sequence 2:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster


Alignment Length:475 Identity:127/475 - (26%)
Similarity:190/475 - (40%) Gaps:121/475 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     3 SSSGSSPRPAPDENEFPFGCPPTVCQDPKEPR------ALCC---AGC-LSENPRNGEDQI---- 53
            |||.|||.|..:.|..|......:.....:|:      ..|.   .|| .|:..|..:..:    
  Fly    66 SSSHSSPTPGNNNNNMPITELEQIIYPGPDPKHIMGSLVFCIHHKQGCKWSDELRKLKGHLNACK 130

Human    54 -----CPKCRGEDLQSISPGSRLR---TQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVT 110
                 ||...|..:..|.....|:   |..:...|..::    .|:|.|         ::||.  
  Fly   131 HDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQS----EFSGAG---------LEEHN-- 180

Human   111 SQTSHLNLLLGFMKQ----WKARLGCGLESGPMAL------------------EQNLSDLQLQAA 153
                      |...|    .:|:.|..:..|.|.|                  |.:...|.|.||
  Fly   181 ----------GSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAA 235

Human   154 VEVAGDLEVDCYRAP--CSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEA------ 210
                     .|.|||  |.:..:...:..       .|||..||.....:||.....||      
  Fly   236 ---------QCPRAPLACPQRCDAGPIPR-------GELEAHLRDECQSLAVSCSFKEAGCRFKG 284

Human   211 ------SHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTF 269
                  :||....:.|         |||   :|.|.....|:.|.|......|.:    ::.||.
  Fly   285 PRQMLEAHLESNAAAH---------LSL---MVALSSRQGQQIQMLKSAVSKLSI----NYTGTL 333

Human   270 LWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYD 334
            |||||:.:.:..|:.....:.|.||.|||::|||||...::|||:|.|:.||:|::|.::.||||
  Fly   334 LWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYD 398

Human   335 ALLPWPFRNKVTFMLLD---QNNREHAIDAFRPDLSSASFQRPQSETN-VASGCPLFFPLSKLQS 395
            |||.|||.:.:||.|.:   |:.:....::|.||.:..:||||.:|.: :..|.|.|.....|.|
  Fly   399 ALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHS 463

Human   396 PKHAYVKDDTMFLKCIVETS 415
              ..::|.||:||:..|:.|
  Fly   464 --RPFIKGDTVFLRVKVDPS 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRAF1NP_001177874.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 9/20 (45%)
SMC_N <140..>263 CDD:330553 32/154 (21%)
TRAF_BIRC3_bd 184..244 CDD:318808 17/71 (24%)
MATH_TRAF1 267..413 CDD:239748 60/149 (40%)
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 22/121 (18%)
zf-TRAF 233..292 CDD:424248 16/74 (22%)
MATH_TRAF4 331..479 CDD:239750 60/149 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3301
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.