DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPTE and aux

DIOPT Version :9

Sequence 1:NP_954870.3 Gene:TPTE / 7179 HGNCID:12023 Length:551 Species:Homo sapiens
Sequence 2:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster


Alignment Length:317 Identity:72/317 - (22%)
Similarity:134/317 - (42%) Gaps:64/317 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   236 DLDLTYVTERIIAMSFPSSGRQSFYR-NPIKEV-----VRFLDKKHRNHYRVYNL--CSERAYDP 292
            |||::::|.||:.|..||.|.:|.|: |.|::|     .||:.:|    ..:||.  .:|....|
  Fly   411 DLDISHITSRILVMPCPSDGFESTYKTNNIEDVRLSLESRFVPQK----LSIYNFGQRTEPRLPP 471

Human   293 KHFHNRVVRIM-------IDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHC--KGGTDRTGTM 348
            .      ||.:       ....:.|.|..:...:.::..::..|.:::|.:..  .||. ...|:
  Fly   472 P------VRTVEAGSVYGCPQAHAPNLQGLFTVSADMYNFLNADPKSVVIVQTGDSGGC-TAATV 529

Human   349 VCAFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRI 413
            :||.|:.:::....::::..|..:|    |:...:    ||:.||:.||..:       |.|..:
  Fly   530 ICALLMYADLLREPEDAVQVFAVKR----HTINLR----PSEFRYLYYFGDI-------LRPTPL 579

Human   414 L-FIKHFIIYS-----IPRY--VRD---LKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVF 467
            | ..|:..:.|     :||.  .||   :.:::.....::.||:...:...|......||::.: 
  Fly   580 LPHYKNTTLVSLSCQPVPRMTKARDGCRIYMEVYCNGNLLLSTLQDYEKMRLYQAGPGKIVLPI- 643

Human   468 DGLPLYDDVKVQFFYSN----LPTYYDNCSFYFWLHTSFI--ENNRLYLPKNELDNL 518
             .|....||.|..|::.    .|.....|.|.|  :|.||  ....:.....:||:|
  Fly   644 -NLTACGDVTVVLFHARKGMVRPQGLKICQFQF--NTGFIPEPETLITFTNQDLDDL 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPTENP_954870.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
PTP_VSP_TPTE 224..400 CDD:350360 43/180 (24%)
PTEN_C2 409..539 CDD:402161 28/127 (22%)
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393 26/121 (21%)
DnaJ <1110..1150 CDD:197617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.