DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Colec11 and lectin-22C

DIOPT Version :9

Sequence 1:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:157 Identity:47/157 - (29%)
Similarity:79/157 - (50%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse   123 IGEMDNQVTQLTTELKFIKNALPSPAAVAGVRETESKIYLLVK-EEKRYADAQLSCQARGGTLSM 186
            :..::..|.::.|::|::           |..:..||.|.:.| .||.::.|..:|:..||.|:.
  Fly   120 LSALEKTVLEVKTKIKYL-----------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLAD 173

Mouse   187 PKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE 251
            .||||....:.:.|.:.  ...::|||||:.||.|:........||.||.||.|:. .|..:|| 
  Fly   174 IKDEADLAAIKANLKED--THYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV- 234

Mouse   252 MVASGGWNDVACHITMYFMCEFDKENL 278
            .:.:|...|..||.|..|:|:.::|:|
  Fly   235 FLYNGEMYDYPCHYTFRFICQTEEEDL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Colec11NP_001300907.1 Collagen 41..96 CDD:189968
CLECT_collectin_like 158..273 CDD:153061 41/115 (36%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 38/112 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10387
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.