DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPM2 and TPM1

DIOPT Version :9

Sequence 1:XP_016870576.1 Gene:TPM2 / 7169 HGNCID:12011 Length:303 Species:Homo sapiens
Sequence 2:NP_014320.1 Gene:TPM1 / 855645 SGDID:S000005023 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:52/207 - (25%)
Similarity:106/207 - (51%) Gaps:8/207 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVK 65
            ||.|::|:..|||:.|:..::.|:.:...|..|....:.|.:.::|..|.:..|||:||....:.
Yeast     1 MDKIREKLSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKNQQLEDEIEKLEAGLS 65

Human    66 EAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 130
            ::    :|.|:...:.|..:.||..:...:|||:::.:..||.:.|..|::......::...|  
Yeast    66 DS----KQTEQDNVEKENQIKSLTVKNHQLEEEIEKLEAELAESKQLSEDSHHLQSNNDNFSK-- 124

Human   131 ENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEE 195
            :|:.:  ||.:|..:.:|||......:||.|.:::.|::..||.:.|..|.:.|....:....::
Yeast   125 KNQQL--EEDLEESDTKLKETTEKLRESDLKADQLERRVAALEEQREEWERKNEELTVKYEDAKK 187

Human   196 ELRTMDQALKSL 207
            ||..:..:|::|
Yeast   188 ELDEIAASLENL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPM2XP_016870576.1 None
TPM1NP_014320.1 Tropomyosin_1 7..186 CDD:403808 45/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.