DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPM2 and Tm2

DIOPT Version :9

Sequence 1:XP_016870576.1 Gene:TPM2 / 7169 HGNCID:12011 Length:303 Species:Homo sapiens
Sequence 2:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster


Alignment Length:213 Identity:101/213 - (47%)
Similarity:149/213 - (69%) Gaps:0/213 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVK 65
            |||||||||.:||:|:||||:|:..|...|.|..|..:|.||.:.|:||....|.::....|.::
  Fly     1 MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTAKEQLE 65

Human    66 EAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 130
            :|..:||:.||..|..|::||:.||::|.:||:|::::||..||.|||.||.::|||:.|..||:
  Fly    66 KANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVL 130

Human   131 ENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEE 195
            |||:.:|||:|:....|||||:.:|||:|.|.:||:|||..:|.|||.:|:|....||:..:|||
  Fly   131 ENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEE 195

Human   196 ELRTMDQALKSLMASEEE 213
            ||:.:..:||||..|||:
  Fly   196 ELKVVGNSLKSLEVSEEK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPM2XP_016870576.1 None
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 76/166 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147727
Domainoid 1 1.000 247 1.000 Domainoid score I2154
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48449
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - mtm8448
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.