DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPM2 and Tm1

DIOPT Version :9

Sequence 1:XP_016870576.1 Gene:TPM2 / 7169 HGNCID:12011 Length:303 Species:Homo sapiens
Sequence 2:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster


Alignment Length:268 Identity:101/268 - (37%)
Similarity:149/268 - (55%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     5 KKKMQ----MLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKG---------TEDE 56
            |||.:    ..|.||....||.::: :.||:...|...:|:...:|...|..         .:|:
  Fly   373 KKKREKGERSEKSDKSEKSDRKKKS-SGKKERSKRSNPMEQSSDSLATDLSAGAIDEGIALADDD 436

Human    57 VEKYSESVK-----EAQEKLEQAEKK-------------------ATD----------------- 80
            ..:.:|..|     ||.|.:.:.|.:                   ::|                 
  Fly   437 DNQAAEWSKLRCTSEAAEIVAEREARRNKGRCADYPGLAFGRSIFSSDTMMKFNIIRNELHNIMN 501

Human    81 -----AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK 140
                 ||::||:|||||||:||:|:|::|||.:|..||.||.:|||||||..|::||||:.|||:
  Fly   502 TQLKRAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEER 566

Human   141 MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALK 205
            |:..|.|||||:.:||::|:||:||||||.::|.:|||:|||||..|::..:||||||.:...||
  Fly   567 MDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLK 631

Human   206 SLMASEEE 213
            ||..|||:
  Fly   632 SLEVSEEK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPM2XP_016870576.1 None
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 72/123 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147726
Domainoid 1 1.000 247 1.000 Domainoid score I2154
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I2689
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - mtm8448
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.