DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPM2 and MGC76092

DIOPT Version :9

Sequence 1:XP_016870576.1 Gene:TPM2 / 7169 HGNCID:12011 Length:303 Species:Homo sapiens
Sequence 2:XP_031746146.1 Gene:MGC76092 / 394917 -ID:- Length:271 Species:Xenopus tropicalis


Alignment Length:213 Identity:123/213 - (57%)
Similarity:156/213 - (73%) Gaps:42/213 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVK 65
            ::|:|:|:|:|:          :||:..::::|..|:.||.|::|.:                  
 Frog     9 IEAVKRKIQVLQ----------QQADEAEEKSERLCRDLEGEKRARE------------------ 45

Human    66 EAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 130
                          .|||:||||||||||||||||||||||:|||||||||||.|||||||||||
 Frog    46 --------------TAEAEVASLNRRIQLVEEELDRAQERLSTALQKLEEAEKTADESERGMKVI 96

Human   131 ENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEE 195
            ||||:||||||||||:||||||||||::|||||||||||||:||:|||:|||||:||||.|.|||
 Frog    97 ENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCRDLEE 161

Human   196 ELRTMDQALKSLMASEEE 213
            ::|.:|.:||.|.|:||:
 Frog   162 QIRMLDHSLKCLNATEEK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPM2XP_016870576.1 None
MGC76092XP_031746146.1 Tropomyosin 14..248 CDD:395200 121/208 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48449
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.