DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPM2 and cdc8

DIOPT Version :9

Sequence 1:XP_016870576.1 Gene:TPM2 / 7169 HGNCID:12011 Length:303 Species:Homo sapiens
Sequence 2:NP_594530.1 Gene:cdc8 / 2541940 PomBaseID:SPAC27F1.02c Length:161 Species:Schizosaccharomyces pombe


Alignment Length:156 Identity:45/156 - (28%)
Similarity:89/156 - (57%) Gaps:6/156 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVK 65
            ||.:::|:...:.:.:.|:.|||.|||..|:.|.:....|:|.::|.:|.:..|.::|:..|..|
pombe     1 MDKLREKINAARAETDEAVARAEAAEAKLKEVELQLSLKEQEYESLSRKSEAAESQLEELEEETK 65

Human    66 EAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 130
            :.:.|.:..:.:.|:||    .|:|:::|:||||:...:.|....:|:.:.:..|:..||.::.:
pombe    66 QLRLKADNEDIQKTEAE----QLSRKVELLEEELETNDKLLRETTEKMRQTDVKAEHFERRVQSL 126

Human   131 ENRAMKDEEKMELQEMQLKEAKHIAE 156
            |..  :|:.:.:|:||..|..|..||
pombe   127 ERE--RDDMEQKLEEMTDKYTKVKAE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPM2XP_016870576.1 None
cdc8NP_594530.1 Tropomyosin_1 7..148 CDD:289488 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.